PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13228.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 70aa    MW: 7840.64 Da    PI: 7.926
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13228.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26096.82.3e-30669164
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64
               +CaaCk++rrkC+++Cv+apyfp +qp+kf nvhk+FGasnv+kll++l+ + reda++sl+ye
  PK13228.1  6 PCAACKIQRRKCTQECVFAPYFPPDQPQKFVNVHKVFGASNVSKLLQELSADSREDAVNSLAYE 69
               7**************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.779570IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-29669IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MQSNSPCAAC KIQRRKCTQE CVFAPYFPPD QPQKFVNVHK VFGASNVSKL LQELSADSRE  60
DAVNSLAYEX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015868740.14e-37PREDICTED: LOB domain-containing protein 36-like
RefseqXP_015890048.14e-37PREDICTED: LOB domain-containing protein 36-like
RefseqXP_010109898.15e-37hypothetical protein L484_013233
SwissprotO044792e-35LBD6_ARATH; LOB domain-containing protein 6
SwissprotQ9FKZ31e-34LBD36_ARATH; LOB domain-containing protein 36
TrEMBLF6HJU33e-37F6HJU3_VITVI; Putative uncharacterized protein (Fragment)
TrEMBLW9SE875e-37W9SE87_9R
STRINGVIT_00s1247g00010.t019e-37(Vitis vinifera)
STRINGVIT_07s0197g00040.t013e-36(Vitis vinifera)
STRINGVIT_16s0022g02050.t013e-36(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-36LBD family protein